menu
Your Cart

BAN2252

BAN2252
  • Gene/Protein:
  • Product Description: Recombinant Nucleocapsid phosphoprotein from SARS CoV-2 [COVID-19]
Recombinant Nucleocapsid phosphoprotein from SARS CoV-2 [COVID-19]
Protein Specification
Sequence

MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKE DLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGAN KDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSR NSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEA SKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGM SRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALP QRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Description

Recombinant Nucleocapsid phosphoprotein from SARS CoV-2 [COVID-19]

Alternate Names

Coronavirus 2019, COVID-10, SARS CoV-2

Molecular Weight

47.5

Safety Note

This product is intended for research and manufacturing uses only. It is not a diagnostic device. Product degradation will result from multiple freeze/thaw cycles. It is suggested that the antigen be stored in use size aliquots and thawed just prior to use. This material has been inactivated, however as with all biological materials, it should be handled as potentially infectious. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations.

Tag

His tag

Source
  1. coli
Formulation

Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH 7.4

Storage

20°C for 12 months as lyophilized; 2-8°C for 1 month under sterile conditions after reconstitution

Material Safety Data Sheet
English_US
Danish
Dutch
English_UK
French
German
Spanish
Norwegian
Portuguese
Finnish
Swedish
Polish

Write a review

Note: HTML is not translated!
Bad Good
Captcha

CONNECT WITH US